Skip to content

DDBJ #
Find similar titles

You are seeing an old version of the page. Go to latest version

DDBJ #

DNA Database Bank of Japan

세계적으로 nucleoic acid 시퀀스의 데이터베이스라 하면 NCBI(미국), European Nucleotide Archive(ENA, 영국) 그리고 DNA Database Bank of Japan(일본)을 꼽습니다. 실제로 genbankEMBL와 함께 서로 정보를 교환하기 때문에 가지고 있는 데이터는 같다고 할 수 있습니다.

일본정부 부처인 MEXT(Japanese Ministry of Education, Culture, Sports, Science and Technology)의 지지를 받고 있는 일본의 미시마에 위치해있는 National Institute of Genetics(NIG)에서 운영을 하고 있습니다.

DDBJ 웹페이지 #

DDBJ 메인화면

그림1. DDBJ 메인화면

  • 검색

    DDBJ 검색

    그림2. DDBJ 검색 검색시 쿼리는 DDBJ/GenBank,EMBL accession을 이용하면 됩니다.

  • 결과 LOCUS LN680001 4233615 bp DNA circular BCT 20-NOV-2014 DEFINITION Bacillus sp. genome assembly BS34ACh ,chromosome : I. ACCESSION LN680001 VERSION LN680001.1 DBLINK Project:PRJEB7328 KEYWORDS . SOURCE Bacillus sp. ORGANISM Bacillus sp. Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus. REFERENCE 1 AUTHORS Smits,Wiep,Klaas. JOURNAL Submitted (24-OCT-2014) to the INSDC. LEIDEN UNIVERSITY MEDICAL CENTER, Department of Medical Microbiology, Postzone E4-P , Albinusdreef 2 , 2300RC, Netherlands FEATURES Location/Qualifiers source 1..4233615 /organism="Bacillus sp." /chromosome="I" /strain="BS34A" /mol_type="genomic DNA" /db_xref="taxon:1409" CDS 410..1750 /codon_start=1 /transl_table=11 /gene="dnaA" /locus_tag="BS34A_00010" /product="chromosomal replication initiator protein DnaA" /inference="ab initio prediction:Prodigal:2.60" /inference="similar to AA sequence:NC_000964.faa:NP_387882.1" /protein_id="CEJ75548.1" /translation="MENILDLWNQALAQIEKKLSKPSFETWMKSTKAHSLQGDTLTIT APNEFARDWLESRYLHLIADTIYELTGEELSIKFVIPQNQDVEDFMPKPQVKKAVKED TSDFPQNMLNPKYTFDTFVIGSGNRFAHAASLAVAEAPAKAYNPLFIYGGVGLGKTHL MHAIGHYVIDHNPSAKVVYLSSEKFTNEFINSIRDNKAVDFRNRYRNVDVLLIDDIQF LAGKEQTQEEFFHTFNTLHEESKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPP DLETRIAILRKKAKAEGLDIPNEVMLYIANQIDSNIRELEGALIRVVAYSSLINKDIN ADLAAEALKDIIPSSKPKVITIKEIQRVVGQQFNIKLEDFKAKKRTKSVAFPRQIAMY LSREMTDSSLPKIGEEFGGRDHTTVIHAHEKISKLLADDEQLQQHVKEIKEQLK" CDS 1939..3075 /codon_start=1 /transl_table=11 /gene="dnaN" /locus_tag="BS34A_00020" /product="DNA polymerase III subunit beta" /EC_number="2.7.7.7" /inference="ab initio prediction:Prodigal:2.60" /inference="similar to AA sequence:NC_000964.faa:NP_387883.1" /protein_id="CEJ75549.1" /translation="MKFTIQKDRLVESVQDVLKAVSSRTTIPILTGIKIVASDDGVSF TGSDSDISIESFIPKEEGDKEIVTIEQPGSIVLQARFFSEIVKKLPMATVEIEVQNQY LTIIRSGKAEFNLNGLDADEYPHLPQIEEHHAIQIPTDLLKNLIRQTVFAVSTSETRP ILTGVNWKVEQSELLCTATDSHRLALRKAKLDIPEDRSYNVVIPGKSLTELSKILDDN QELVDIVITETQVLFKAKNVLFFSRLLDGNYPDTTSLIPQDSKTEIIVNTKEFLQAID RASLLAREGRNNVVKLSAKPAESIEISSNSPEIGKVVEAIVADQIEGEELNISFSPKY MLDALKVLEGAEIRVSFTGAMRPFLIRTPNDETIVQLILPVRTY"

0.0.1_20210630_7_v33